SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|117924220|ref|YP_864837.1| from Magnetococcus marinus MC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|117924220|ref|YP_864837.1|
Domain Number 1 Region: 197-330
Classification Level Classification E-value
Superfamily CBS-domain pair 4.93e-28
Family CBS-domain pair 0.0029
Further Details:      
 
Domain Number 2 Region: 334-411
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.64e-18
Family CorC/HlyC domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|117924220|ref|YP_864837.1|
Sequence length 412
Comment hypothetical protein Mmc1_0912 [Magnetococcus marinus MC-1]
Sequence
MESWLILLLMALFLLMEGFFSGSEIGVVNADKLKLRHQAAKGCRGSRLALDMLEKPEWLL
ATTLVGTNIAIVSNTTLATLLATQWLGEGKGWVAILFVAPLIWIVGEIVPKSIFQEHADT
ITPRVIFVLKGASVLFYPVLLIFTLFTRLITLVVGRGKARNPYTLREELDLMLQMPNHED
GDVQQEERTMIRRMFTFSELRARDIMVPLIQVVSTTRTATCGEALALCAQHGHTRLPVYA
GRVDNLVGHVSGLDLLGQPKQSPISPFIKPVPYVPMSKPVEDLLVEFRKSGEHVAVVVGE
FGGSQGIMTLEDILERVVGDIEDEYDTKEQSPRWVQKINPTTYVVSAGMDVVALKERIGV
ELPEGSYKTLGGFMLEHLEDIPKVGQSLNYHKMTFTVEKATRKMIQEVKITF
Download sequence
Identical sequences A0L638
gi|117924220|ref|YP_864837.1| 156889.Mmc1_0912 WP_011712588.1.83473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]