SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|114798310|ref|YP_758840.1| from Hyphomonas neptunium ATCC 15444

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|114798310|ref|YP_758840.1|
Domain Number 1 Region: 52-195
Classification Level Classification E-value
Superfamily CBS-domain pair 9.85e-35
Family CBS-domain pair 0.0019
Further Details:      
 
Domain Number 2 Region: 193-282
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.26e-16
Family CorC/HlyC domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|114798310|ref|YP_758840.1|
Sequence length 286
Comment CBS/transporter associated domain-containing protein [Hyphomonas neptunium ATCC 15444]
Sequence
MSDSDPSDAGPSGRLRSLFGFRKKTPEPATAASRDLDPAGAPQVMRLRLAEFEELRVDDV
MVPRADIKAVEAGTGIQELLEFFAEVTHSRLPVFRESLDDPIGFVHIKDLVTELAKGGTP
PRRPLESLHREVLYVPPSMKLTDLLVKMQATRIHLALVVDEYGGTDGLITLEDLVEVIVG
DIEDEHDDEEAMFVRRSARVWEADARTEIEDFQEEAGVDLSLDDLDADIDTLGGVAFALA
GKVPVRGEVLRHPGGTEIEIVDADSRRVRRLRLRLPEPPPQPAAEE
Download sequence
Identical sequences A0A059FWS5 Q0C603
WP_011645140.1.33885 WP_011645140.1.6977 228405.HNE_0106 gi|114798310|ref|YP_758840.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]