SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153003121|ref|YP_001377446.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003121|ref|YP_001377446.1|
Domain Number 1 Region: 51-497
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 3.01e-91
Family Nitrous oxide reductase, N-terminal domain 0.00000034
Further Details:      
 
Domain Number 2 Region: 517-620
Classification Level Classification E-value
Superfamily Cupredoxins 2.21e-27
Family Nitrosocyanin 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153003121|ref|YP_001377446.1|
Sequence length 647
Comment nitrous-oxide reductase [Anaeromyxobacter sp. Fw109-5]
Sequence
MSSSKSVSKPLAIAAVLVAAAAVAVRCAPREPKGARREAAKSDVSVAAQKTYVAPGDLDE
YYMFSSGGHSGQVFIYGLPSMRHLATIPVFAPYPATGYGFDDETKEMLGKLTWGDVHHPA
LSETKGDYDGRWLFVNEMNGRIARIDLRDFKTRQIIGPVPNVSGNHGSAFVTPNTEYAMM
SSRFSIPIPKGTAVSIDKYASEYKGIVAGIKIDPESGKMSLGWQVALPPFDWDLGDAGKL
VSDGWMFLTCYNSERGTGKLEVTASQRDRDYIAAINWREAEKAAAEGKGDLIGGVKVLDP
RKVPGLVYLMPCGKSPHGVDVSPDGKYIIGSGKLQGVTTAFNFEKVLTAIKNKDFTGEED
GIPVLKYESIKDAEVPVGLGPLHTQFGPDGWAYTSLFVDSALAKWKLGTWEVVDKVPMSY
STGHLSAAEGDTVSPDGKWLVGLNKLSHGRHLSVGPSQPESSQLVDISEDKMKLVYDAFT
EPEPHYAQIIKADKVKPIEVYKKEENKNPLAVWDVKDTGASRKGNEVVVKMTAVRSTFTP
QLIEVNQGDTVKVAVTNIEQTTDELHGFGLLDYNINLVVDPGETKVVTFKADKPGVFPYY
CTNFCSALHQEMQGYLVVRPARAAAPAEGDEGGGARAGREETRRGPR
Download sequence
Identical sequences A7H6W6
gi|153003121|ref|YP_001377446.1| 404589.Anae109_0244 WP_011984568.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]