SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119963887|ref|YP_949829.1| from Arthrobacter aurescens TC1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119963887|ref|YP_949829.1|
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.12e-21
Family Ribosomal protein L9 C-domain 0.00083
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 8.02e-17
Family Ribosomal protein L9 N-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119963887|ref|YP_949829.1|
Sequence length 150
Comment 50S ribosomal protein L9 [Arthrobacter aurescens TC1]
Sequence
MAKLILTHEVTGLGAAGDVVEVKDGYARNFLLPRGFALTWTKGGEKQVESIKAARAARAH
ASVEAAQAQAQALSSKKVKLEVKAGESGRLFGTVKPADVAAAVEAAGLGAIDKRNVELPN
HIKSVGSYTANVRLHEDVSAVIDLEVVAAK
Download sequence
Identical sequences A1RC67 J7M0L2
WP_011776753.1.67142 WP_011776753.1.83037 290340.AAur_4162 gi|119963887|ref|YP_949829.1| gi|403529315|ref|YP_006664202.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]