SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119964409|ref|YP_948612.1| from Arthrobacter aurescens TC1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119964409|ref|YP_948612.1|
Domain Number 1 Region: 4-181
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2e-43
Family Phosphoglucomutase, first 3 domains 0.00053
Further Details:      
 
Domain Number 2 Region: 258-365
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2e-29
Family Phosphoglucomutase, first 3 domains 0.0056
Further Details:      
 
Domain Number 3 Region: 158-256
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.29e-27
Family Phosphoglucomutase, first 3 domains 0.00091
Further Details:      
 
Domain Number 4 Region: 359-447
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.96e-21
Family Phosphoglucomutase, C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119964409|ref|YP_948612.1|
Sequence length 454
Comment phosphoglucosamine mutase [Arthrobacter aurescens TC1]
Sequence
MSRLFGTDGVRGLANGLLTAELAMQLAQAAAVVLGHDRTTDGKRPRAVVARDPRASGEFL
AAAVEAGLSSSGIDVYDAGVLPTPAAAYLVADLDADFGVMLSASHNPAPDNGIKFFARGG
QKLPDDVEDAIEAQLGKEPQRPVGADVGRIQRFSDAEDRYIVHLLGTLPKRLEGLKVVLD
CAHGAASGCSPQVFKDAGAEVVVIGAEPDGLNINDGVGSTHLGPLKEAVVKHGADLGVAH
DGDADRCLAVDHEGNEVDGDQIMAILALALKEAGKLKDNILVATVMSNLGLKIALRDAGI
TIRETGVGDRYVLEEMRDGGYNLGGEQSGHVIFSDFATTGDGVLTGLQLAAQVALTGRSL
KDLSSAMTKLPQLMINVKDVDKARAATDEGVAEAVAAAELELGETGRVLLRPSGTEALVR
VMVEAADMETAERICKGLAAVVKERLGAPSELAV
Download sequence
Identical sequences A1R8Q0 J7LYN4
290340.AAur_2903 WP_011775552.1.67142 WP_011775552.1.83037 gi|403528090|ref|YP_006662977.1| gi|119964409|ref|YP_948612.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]