SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150400048|ref|YP_001323815.1| from Methanococcus vannielii SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150400048|ref|YP_001323815.1|
Domain Number 1 Region: 3-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-33
Family GHMP Kinase, N-terminal domain 0.00000248
Further Details:      
 
Domain Number 2 Region: 167-296
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.06e-33
Family Homoserine kinase 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150400048|ref|YP_001323815.1|
Sequence length 302
Comment homoserine kinase [Methanococcus vannielii SB]
Sequence
MKKVKVCAPGTSANLGPGYDIFGIALSKPYDIVTIEKVDEFGIKITLEGEKAEEIPTNVE
ENTAGVVAKKMIEDFKIESGIHIHIVKGIKPGSGLGSSSASCAGVAFGLNELFELKLSKL
DLVKYASLGEAVAAGAPHADNVAPAIFGGFTLTTNYEPLEVLHIPVEIDVIVALPNIQVS
TKSAREILPKEVPMKSMVNNVGKAAGMIYALYNNDLDLFGQYMSKDAVVEPCRAQLITGY
LEIKEKLKDLVYGVTISGSGPAIIAIPKKEHVIDIKNIFKEVYNCPVYYTRVGLGCYIEE
IE
Download sequence
Identical sequences A6URT1
gi|150400048|ref|YP_001323815.1| WP_012066118.1.66029 406327.Mevan_1306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]