SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150400359|ref|YP_001324126.1| from Methanococcus vannielii SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150400359|ref|YP_001324126.1|
Domain Number 1 Region: 74-207
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.26e-24
Family Ribonuclease H 0.0061
Further Details:      
 
Domain Number 2 Region: 3-47
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.000000000000476
Family N-terminal domain of RNase HI 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150400359|ref|YP_001324126.1|
Sequence length 209
Comment ribonuclease H [Methanococcus vannielii SB]
Sequence
MAKIYAVRNGRKTGIFDTFEECEKQVKGFSGAEFKSFNLKSDAEKYLDINNLSSSTKLEN
LNQNRILYTNEDLDTMHAFVDGSFNLKTGFYGAGVYIIHNDLKTEIKQKGNNPAFSKMRN
VAGEILAAELAIKHASSKNVKNLIIYYDYFGIEKWCTGEWKTKMLGTAKYREIYLEHSVK
INIKFIKIKAHSKEKNNEIADRLAKESLI
Download sequence
Identical sequences A6USP2
406327.Mevan_1622 gi|150400359|ref|YP_001324126.1| WP_012066428.1.66029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]