SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152964151|ref|YP_001359935.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152964151|ref|YP_001359935.1|
Domain Number 1 Region: 172-548,585-645
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 9.45e-121
Family Alkaline phosphatase 0.0000105
Further Details:      
 
Weak hits

Sequence:  gi|152964151|ref|YP_001359935.1|
Domain Number - Region: 149-179
Classification Level Classification E-value
Superfamily PKD domain 0.0549
Family PKD domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152964151|ref|YP_001359935.1|
Sequence length 671
Comment alkaline phosphatase [Kineococcus radiotolerans SRS30216]
Sequence
MSDTQSTADENNSQERRGFFTRRGLLGTGGLATAVVFGKGLVDASAASAAPAYVPAQLNA
KDAHYSTTFRRITRSTGTGSAVKVLPLDRAKFQVGSTFDLRVEATGVDPETTRIVIRVSD
GSGPAPLLGPAPVRTSSAPDSVEVTYRDFVYPAAGTFTIAAAVSSSAGSASQEVTHEVVL
ADASGETAKNVIFFLGDGMGQAAITGARILSKGITEGKYDAFLEMDTLDFRGNVTTSGSD
SIATDSANSMSAYMTGHKTAVNAMGVYPGNSEDPTASPRVETMAEVLKRSRGMSIGIVTT
AEIQDATPAAVFAHTRRRSEYLDIMEQALTPEQMPDVYMGGGRASLLPQSQKGSRRTDER
NLIEEFKDKGFAYAGTRTELSAVMAAGTPDKLLGTFHNGNLNVYIDRRITPDPAVLGEFP
DQPGLVEMTRAALKVLEKNDKGFFLMVEGASIDKSEHPLDGPRAVYDTIELDQAVAVAKE
WAKDRDDTLIVVTADHNHAMSIAGTHTLSREGSPARQQNGVYADAGFPTYVDADGDGFPD
DPNPDVQLFFGWSNHPDHPDDFAHNPVLAQPALEDPATEQAFPNPNRDPGAVVQIGNLPL
EETNCVHTVEDVFIGASGPGAQRFAKLLDNTEVFHNVIAALGLQIPTYSLRSSGGKVAEA
EVAATEATPAG
Download sequence
Identical sequences A6W4D2
gi|152964151|ref|YP_001359935.1| 266940.Krad_0180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]