SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152964833|ref|YP_001360617.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152964833|ref|YP_001360617.1|
Domain Number 1 Region: 10-504
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.09e-191
Family Heme-dependent catalases 0.00000000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152964833|ref|YP_001360617.1|
Sequence length 551
Comment catalase [Kineococcus radiotolerans SRS30216]
Sequence
MTDVASQSSAPGDERPVLTNRQGHPVYDNQNQRTVGARGPATLENYQFLEKISHFDRERI
PERVVHARGTTAFGYFEAYGSFGDEPISKYTRAKLFQEKGKRTDLAIRFSTVAGGRDSAE
TLRDPRGFAVKMYTEDGNWDLVGNNLGVFFIRDAIKFPDFIHSQKPDPVTFDRQVPNRVF
DFASQTPESLHMFTLVFSPRGIPASYRTQQGFGVNTYKWVNSEGETVLVKYHWHPKQGVK
SWTSADAAAVQAQDLGPHTRDLYAAIDAGDYPEWELLVQTMSDEEHPELDFDPLDDTKVW
PENLFPLTPIGKMVLNRKPVDFFTESEQIAFGTGVLVDGLDFSDDKMLVGRTFSYSDTQR
YRVGPNYLQLPVNAAKVPVRTNQRDGQMAYGVDGRGENPTVNYEPSIIGGLREGTYPTHD
EQGPVITGRVTRKRIPRTNDYQQAGERFQLSEDWEKDELVANFVDALSQCIRPIQERMVW
HMFMADDEYGRRVGEGLGITADDVRHLEPLQTQTLTEEELQRAANLGKNGPRDVTGLVMT
HAVPNERDVRA
Download sequence
Identical sequences A6W6B4
WP_012084798.1.7041 gi|152964833|ref|YP_001360617.1| 266940.Krad_0865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]