SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152965592|ref|YP_001361376.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152965592|ref|YP_001361376.1|
Domain Number 1 Region: 1-331
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.27e-50
Family Phase 1 flagellin 0.0000582
Further Details:      
 
Domain Number 2 Region: 332-528
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.7e-35
Family Phase 1 flagellin 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152965592|ref|YP_001361376.1|
Sequence length 529
Comment flagellin domain-containing protein [Kineococcus radiotolerans SRS30216]
Sequence
MGLRINNNIAAVNSYRNLAASDKAMSGSLEKLSSGFRINKAADDAAGLVVSEGLRSQING
MTQAARNAQDGVNVAQTADGALGVSTSILQRMRDLATQAANAGSQDVLAKDAAQKELTQL
NAELDRISTTTSFGNTKLLDGTYGVTAKVDGDASTRAVSASNPIEIRSAAVTNRNDVAAL
TTVSVNGASATLTIASTNLPAKQEFADANAYAAALTTAARTQLTADGGSAAVDGTLTATA
AVDKATGLVTISWTQTGGTGPAAGTRTPGGGQSALSGGDAIRAGVDGKVSTRDLAANNIL
NLRNLKTASGESFGPATGVDVTLDAADHASADALLTAVNAKISSALIAAGGKGDEVVMKN
DVVPGGTGYKLSLTSISSDFTLGATTNALGLTSSATVQKGNTGVFQVGANAGETITMGVT
GVSSAALGTSSIDLRVNASEAITKISKALDSISSQRASIGAIQNRFEHAVNNLNVSIENI
TASESAIRDTDMAKEMTKFTKNQILSQAGTSMLAQANSASQNILSLLRG
Download sequence
Identical sequences A6W8H3
266940.Krad_1626 gi|152965592|ref|YP_001361376.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]