SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152965983|ref|YP_001361767.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152965983|ref|YP_001361767.1|
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 8.06e-24
Family DNA-binding N-terminal domain of transcription activators 0.0011
Further Details:      
 
Domain Number 2 Region: 121-276
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.71e-20
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152965983|ref|YP_001361767.1|
Sequence length 286
Comment MerR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence
MFSIGEFATIARVSVRVLRHYDALGLLPPAAVDPATGYRSYSAAQLARLNRVLALKDLGL
TLQQVRAVLDEEVGVQELHGMLRLRRAELTEQVAADTARLRAVEVRLQVIEEEGTMGTQD
VIVKDTDPVRVAELSAVAASFEPDHIGPVIQPLYGELYRRLAQAGIQSAGPGVAWYEHVD
GGDGEEGEAVRVHAGVVVAAQEQARGGVQVTDRPGVRAATIVHHGPMDGVDATWQVLARW
VADSGHRPLGLGGEVYLDYCPEDPADGVTELQIPIAPAAGDRQDRT
Download sequence
Identical sequences A6W9L4
WP_011981358.1.7041 266940.Krad_2018 gi|152965983|ref|YP_001361767.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]