SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152967100|ref|YP_001362884.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152967100|ref|YP_001362884.1|
Domain Number 1 Region: 99-166
Classification Level Classification E-value
Superfamily C-terminal domain of arginine repressor 9.42e-18
Family C-terminal domain of arginine repressor 0.0013
Further Details:      
 
Domain Number 2 Region: 12-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.99e-17
Family Arginine repressor (ArgR), N-terminal DNA-binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152967100|ref|YP_001362884.1|
Sequence length 184
Comment arginine repressor [Kineococcus radiotolerans SRS30216]
Sequence
MSTPTGAGAGTKAFRHDRIAAVLARSPVRSQTELATHLAAEGVAVTQATLSRDLVELGAV
KVRDGDRGLVYALPAEGGDRTPRRGVGQEVLDARLSRWCEELLVSAEASANLVVLRTPPG
AAQFLASAIDHSVMPAVLGSIAGDDTVLVISRDPLGGDAVAARFLAMARRDPPSEPLENE
VDPS
Download sequence
Identical sequences A6WCT1
266940.Krad_3156 gi|152967100|ref|YP_001362884.1| WP_012087127.1.7041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]