SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152967489|ref|YP_001363273.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152967489|ref|YP_001363273.1|
Domain Number 1 Region: 133-201
Classification Level Classification E-value
Superfamily PKD domain 0.00000000942
Family PKD domain 0.0048
Further Details:      
 
Domain Number 2 Region: 383-439
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000697
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152967489|ref|YP_001363273.1|
Sequence length 510
Comment cell wall binding repeat 2-containing protein [Kineococcus radiotolerans SRS30216]
Sequence
MSRRCSGEQIDRPEEPPVPNEPTHRLVLGLSAAMVLALSSAAVTAPAQAAGDGAAARDVL
EVEVRPAIATPSGVVTVVAEYDARHRADDSEDSGDDSGDDSGDDSGDAADDSDGAGGSGD
DPGAGAPAPLSTLKAPATGAVALSVDFGDGSAPEAMRVVGSAATPKAFGKHRYTTAGTFT
VTVTATPSTGTPVSVPVQVQVGRGSARLAGADRFETANRLAREDFPTDGEAGAVLLARSD
GFADALAAAPAALLAEAPVLLTPTADLPDSVHREIARALGASGKVYVLGGEGAVSPAVVT
ELEASGYEVVRIAGRDRVETALLLARFLVDSGARVDEVVLTGSLNFPDALSGAAFAASTD
APVLLTAPGALDPRVAAFLAQLGPVRVLVTGGTSSVGDAVVAELTAAGHRVQRLAGADRY
ETSAEVATELFPAATTVVLATGRNFPDALAGAPAAGRRGAPVLLVGTELAPSVREYLRAG
AGRIEAVYVLGGEGTVPAGVLSEVDAILGS
Download sequence
Identical sequences A6WDX0
gi|152967489|ref|YP_001363273.1| 266940.Krad_3546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]