SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152968096|ref|YP_001363880.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152968096|ref|YP_001363880.1|
Domain Number 1 Region: 10-302
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.44e-72
Family Acetamidase/Formamidase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152968096|ref|YP_001363880.1|
Sequence length 305
Comment acetamidase/formamidase [Kineococcus radiotolerans SRS30216]
Sequence
MNQVLRPDPESVTDVFDPARPPVLTVEPGERFVVEALDARGFLERPAHPGAAAPRRFPVS
RGHCLAGPVAVRGAGPGDVLAVTLHSVRTSGWGWTSAGFPSPLNSRLGATTPVELLWDID
DEAGTATNQLGFTVDTAPFLGVVGTTPAAPGEHPTTPPRTGHGGNVDCRSLVAGSTLYLP
VHVPGALLCLGDGHAAQGDGEVCGTAVECGTTSELTVAVVDAPALPSVHAVTPTERITFG
FDADLNTATDTALGDLVTWVAAEHGLDRSTALALLSTCADLRVTQVANETWGVHAALRHD
ALRRV
Download sequence
Identical sequences A6WFM7
gi|152968096|ref|YP_001363880.1| 266940.Krad_4153 WP_012086091.1.7041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]