SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152965202|ref|YP_001360986.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152965202|ref|YP_001360986.1|
Domain Number 1 Region: 208-348
Classification Level Classification E-value
Superfamily CBS-domain pair 2.15e-27
Family CBS-domain pair 0.0042
Further Details:      
 
Domain Number 2 Region: 353-432
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.02e-20
Family CorC/HlyC domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152965202|ref|YP_001360986.1|
Sequence length 453
Comment hypothetical protein Krad_1234 [Kineococcus radiotolerans SRS30216]
Sequence
MLTEWLLLLVGVLLTLGTAVFVAAEFALVTLDRFSVEKAVEDGDKRAAGILPALRTLSTQ
LSGAQVGITLTTLLVGYLTKPSLASLLNGPLTSAGLSPDSADSVAGILAVVVAAAFSMVV
GELIPKNLALSVPLRTAGVVAPLQRGFTWATGPLLKVLNGSANWFLRRIGVEPQEELSGA
RSARELAALVRRSADMGTLDEGTANLISRSLLFGDQTAADVMTPRVRMEAIRLDETAADV
VARARTTGHSRFPVTGDDDDDVRGVVHVKAAVAVPPERRHDVPAAALMADARRVPDSLTL
EPLLLQLRQKGLQLAVVVDEYGGTAGVVTLEDLVEEIVGDVSDEHDRDRGGLRQHRDASW
TVPGLARPDEVRDATGVEVPEDPAYETLGGFVMSRLRRIPAVGDEIELDGAVLRVARMEG
RRVERLRLRPRPVTPVGTVPAPEAAGAVAGGDR
Download sequence
Identical sequences A6W7D3
WP_012084422.1.7041 266940.Krad_1234 gi|152965202|ref|YP_001360986.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]