SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152967329|ref|YP_001363113.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152967329|ref|YP_001363113.1|
Domain Number 1 Region: 198-343
Classification Level Classification E-value
Superfamily CBS-domain pair 1.64e-32
Family CBS-domain pair 0.0018
Further Details:      
 
Domain Number 2 Region: 339-426
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000409
Family CorC/HlyC domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152967329|ref|YP_001363113.1|
Sequence length 438
Comment hypothetical protein Krad_3385 [Kineococcus radiotolerans SRS30216]
Sequence
MGAPAVPLLLLALVLVVAAGLVAAAESAIAGTSRRRARELEADGRRGAAELDRVLGSATS
VLTVATLLRVVFETLAAVCVAVVVASWVDSWWLVLLLAGLGMSALDFVLVGVGPRTLGRL
HAETVARRAAPVLGPLTTVLGPLARALVAVGNAVTPGRGMRQGPFGSEAELREIVELAGE
TSVIEAGERRMINSVFELGDTLVREVMVPRTDVVSARRGAGLHEVEALLLRSGFSRMPVI
GEDADEVLGIVYLKDVARRFHTDPVAARAERVETVARQTVFVPDSLPVDELLRQMQRDTT
HVAIVVDEYGGTAGLVTIEDVIEEIVGDIADEYDRAAPDVEPLPDGGFRVSSRLHVEDLG
ELFEKEIEDEDVDTVGGLLAKTLGEVLVPGAVAEVHGLRLEADARVGRRNQVRTVLVHRL
PEHEPELVDDHAGGHQHD
Download sequence
Identical sequences A6WDG0
gi|152967329|ref|YP_001363113.1| WP_012086892.1.7041 266940.Krad_3385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]