SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118462335|ref|YP_882629.1| from Mycobacterium avium 104

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118462335|ref|YP_882629.1|
Domain Number 1 Region: 112-290,414-584
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.06e-97
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000866
Further Details:      
 
Domain Number 2 Region: 287-409
Classification Level Classification E-value
Superfamily GAD domain-like 5.01e-34
Family GAD domain 0.00032
Further Details:      
 
Domain Number 3 Region: 3-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.95e-29
Family Anticodon-binding domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118462335|ref|YP_882629.1|
Sequence length 591
Comment aspartyl-tRNA synthetase [Mycobacterium avium 104]
Sequence
MLRSHAAGSLRSSDAGQQVTLAGWVARRRDHGGVIFIDLRDASGITQVVFRDPDVLKQAH
RLRAEFCVAVAGLVEIRPEGNANPEIATGDIEVNASSLTVLGESAPLPFQLDEPAGEELR
LKYRYLDLRRDAPAAAIRLRSKVNAAAREVLDRHDFVEIETPTITRSTPEGARDFLVPAR
LHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDA
EDVIAISEEILAALWALIGYEIPRPIPRISYADAMARYGSDKPDLRFGLELVECSEFFKD
TTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEWAKQRGAKGLAYVLVGEDGELGGPVAKN
LSEAERAGLAGHVGAAPGDCIFFAAGPAKPSRALLGAARSEIAHRLGLIDPQAWAFVWVV
DPPLFEPADDATAAGDVAVGSGAWTAVHHAFTAPKPGYEDAIETDTGNVLADAYDIVCNG
NEIGGGSIRIHRRDIQERVFAVMGLDNAEAREKFGFLLEAFTFGAPPHGGIAFGWDRINA
LLSRVDSIREVIAFPKTGGGVDPLTDAPAPITEQQRKESGIDVKPEPSKPH
Download sequence
Identical sequences A0A049DDK0 A0QI91 V7J7L7
WP_011725475.1.101159 WP_011725475.1.16293 WP_011725475.1.17321 WP_011725475.1.18785 WP_011725475.1.20882 WP_011725475.1.21325 WP_011725475.1.22600 WP_011725475.1.2690 WP_011725475.1.31474 WP_011725475.1.32203 WP_011725475.1.32247 WP_011725475.1.35384 WP_011725475.1.42004 WP_011725475.1.42052 WP_011725475.1.42684 WP_011725475.1.48008 WP_011725475.1.49379 WP_011725475.1.51803 WP_011725475.1.54538 WP_011725475.1.55522 WP_011725475.1.55781 WP_011725475.1.57680 WP_011725475.1.6247 WP_011725475.1.62782 WP_011725475.1.6371 WP_011725475.1.65674 WP_011725475.1.65884 WP_011725475.1.66097 WP_011725475.1.66967 WP_011725475.1.68982 WP_011725475.1.69393 WP_011725475.1.70933 WP_011725475.1.72172 WP_011725475.1.74476 WP_011725475.1.7463 WP_011725475.1.74957 WP_011725475.1.75695 WP_011725475.1.80001 WP_011725475.1.87519 WP_011725475.1.93735 WP_011725475.1.94747 WP_011725475.1.95627 gi|118462335|ref|YP_882629.1| 243243.MAV_3447 MyavA.00145.a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]