SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118463626|ref|YP_882702.1| from Mycobacterium avium 104

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118463626|ref|YP_882702.1|
Domain Number 1 Region: 5-303
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.36e-77
Family Heme-dependent catalases 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118463626|ref|YP_882702.1|
Sequence length 313
Comment catalase [Mycobacterium avium 104]
Sequence
MSGGLTPDQAIEAIRGTGGAQPGCRALHAKGTLYRGTFTATRDAVMLSAAPHLDGSTVPA
LIRFSNGSGNPKQRDGAPGVRGMAVKFTLPDGSTTDVSAQTARLFVSSTPEGFIDLLKAM
RPGLTTPLRLATHLLTHPRLLGALPLLREANRIPASYATTEYHGLHAFRWIAADGSARFV
RYHLVPTAAEEYLSASDARGKDPDFLTDELAARLQGGPVRFDFRVQIAGPTDSTVDPSSA
WQSTQIVTVGTVTITGPDTEREHGGDIVVFDPMRVTDGIEPSDDPVLRFRTLVYSASVKL
RTGVDRGAQAPPV
Download sequence
Identical sequences A0A049DE09 A0A0H2ZVD7 V7J7K2 V7N9U3 X8AZU2
243243.MAV_3520 WP_011725516.1.101159 WP_011725516.1.14691 WP_011725516.1.17321 WP_011725516.1.18785 WP_011725516.1.21325 WP_011725516.1.22600 WP_011725516.1.2690 WP_011725516.1.32203 WP_011725516.1.32247 WP_011725516.1.35384 WP_011725516.1.40244 WP_011725516.1.42004 WP_011725516.1.42052 WP_011725516.1.42684 WP_011725516.1.48008 WP_011725516.1.49379 WP_011725516.1.51803 WP_011725516.1.55781 WP_011725516.1.57680 WP_011725516.1.62105 WP_011725516.1.6247 WP_011725516.1.62782 WP_011725516.1.65121 WP_011725516.1.65674 WP_011725516.1.65884 WP_011725516.1.66097 WP_011725516.1.66967 WP_011725516.1.68982 WP_011725516.1.69393 WP_011725516.1.70933 WP_011725516.1.72172 WP_011725516.1.7463 WP_011725516.1.74957 WP_011725516.1.75695 WP_011725516.1.80001 WP_011725516.1.80920 WP_011725516.1.85628 WP_011725516.1.87519 WP_011725516.1.93735 WP_011725516.1.94747 WP_011725516.1.95627 WP_011725516.1.98895 gi|118463626|ref|YP_882702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]