SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118463936|ref|YP_884047.1| from Mycobacterium avium 104

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118463936|ref|YP_884047.1|
Domain Number 1 Region: 4-482
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.22e-184
Family Heme-dependent catalases 0.000000000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118463936|ref|YP_884047.1|
Sequence length 484
Comment catalase KatA [Mycobacterium avium 104]
Sequence
MAENHTTTNAGAPAPSDELSLTVGPDGPLLLQDSYLVEQMAAFNRERVPERQPHAKGAGA
YGRFEVTADVSEYTKAAFLQPGAVTEVFARFSSGNSGERGSADTARDNRGFSVKFYTTEG
NFDLVGSDVPVFAIRDPMKFPNLIRAGGRRADNDLHDHNMVWDFWTSCPETAHLVTLVMG
DRGIPRTFRHMNGFGLHAFSWVNSAGEIHWVKYHFKTDQGIQWLPQEEGRRLAGTHPDCC
VRDLYEAIARGEYPSWSLQVQLMPFADAKTYRFNPFDVTKVWPHADYPPIEVGTMTLDRN
VTDHHAEVEQAAFAPSNLVPGTGLSPDRLLLGRSFAYPDAHRARIGVNHDQLPVNAARCA
VRSYAKDGRMRIVNTADPVYAPNSAGGPHADPARAGEVHWAADGQMLRAAYTLRRDDDDW
GQAGTLVRRVMDDAQRERLVHNIVGHVSAGVNEPVLSRVFAYWRHVDPDIGRKVEEGVRA
NLNS
Download sequence
Identical sequences A0A049DLQ8 A0A0H2ZUS8 V7JD39 V7LKH5 V7LNQ2
WP_011726337.1.1472 WP_011726337.1.16293 WP_011726337.1.17321 WP_011726337.1.21325 WP_011726337.1.22600 WP_011726337.1.2690 WP_011726337.1.31474 WP_011726337.1.32247 WP_011726337.1.35384 WP_011726337.1.39409 WP_011726337.1.40244 WP_011726337.1.42004 WP_011726337.1.42052 WP_011726337.1.42684 WP_011726337.1.48008 WP_011726337.1.51803 WP_011726337.1.55781 WP_011726337.1.57680 WP_011726337.1.6247 WP_011726337.1.62782 WP_011726337.1.6371 WP_011726337.1.65121 WP_011726337.1.65884 WP_011726337.1.66097 WP_011726337.1.66967 WP_011726337.1.68982 WP_011726337.1.72172 WP_011726337.1.74476 WP_011726337.1.7463 WP_011726337.1.80001 WP_011726337.1.85628 WP_011726337.1.87519 WP_011726337.1.93735 WP_011726337.1.93753 WP_011726337.1.94747 WP_011726337.1.95627 WP_011726337.1.9971 gi|118463936|ref|YP_884047.1| 243243.MAV_4926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]