SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118464352|ref|YP_881554.1| from Mycobacterium avium 104

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118464352|ref|YP_881554.1|
Domain Number 1 Region: 17-174
Classification Level Classification E-value
Superfamily PEBP-like 3.01e-50
Family Prokaryotic PEBP-like proteins 0.0000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118464352|ref|YP_881554.1|
Sequence length 176
Comment hypothetical protein MAV_2351 [Mycobacterium avium 104]
Sequence
MSTAPDPYASLPKLPTFTLTSQSLTDGGTLAKPQVSGIMGAGGEDVSPQLSWSGFPAETR
SFAVTVYDPDAPTASGFWHWAVANLPADVTELPAGAGDGSNLPGDALTLVNDAGQRRYIG
AAPPPGHGPHRYYIAVHAVDTEKLDLPEDASPAFLGFNLFQHAIARAVIHGTYEQK
Download sequence
Identical sequences A0A0E2WAM8 A0A0H2ZX70 A0A200GR18 A0A2A2ZZ77 A0A2A3L3E4 Q73YS0 T2GW20 V7J5Z6 V7JHN3 V7KQ38 V7L1U6 V7LH06 V7P4V8 X7VEU6 X8AYS3
gi|499076294|ref|YP_007971772.1| 243243.MAV_2351 262316.MAP1885c WP_003872213.1.10000 WP_003872213.1.101064 WP_003872213.1.12505 WP_003872213.1.12954 WP_003872213.1.1369 WP_003872213.1.14373 WP_003872213.1.14691 WP_003872213.1.14707 WP_003872213.1.1472 WP_003872213.1.14816 WP_003872213.1.15663 WP_003872213.1.1614 WP_003872213.1.16945 WP_003872213.1.17266 WP_003872213.1.17321 WP_003872213.1.17624 WP_003872213.1.17884 WP_003872213.1.17915 WP_003872213.1.1994 WP_003872213.1.21011 WP_003872213.1.22278 WP_003872213.1.22949 WP_003872213.1.23768 WP_003872213.1.26008 WP_003872213.1.27647 WP_003872213.1.27804 WP_003872213.1.28864 WP_003872213.1.29527 WP_003872213.1.32203 WP_003872213.1.33234 WP_003872213.1.3468 WP_003872213.1.34688 WP_003872213.1.35384 WP_003872213.1.35500 WP_003872213.1.35510 WP_003872213.1.35606 WP_003872213.1.36073 WP_003872213.1.37369 WP_003872213.1.37642 WP_003872213.1.38978 WP_003872213.1.39409 WP_003872213.1.3962 WP_003872213.1.40837 WP_003872213.1.4542 WP_003872213.1.45459 WP_003872213.1.45501 WP_003872213.1.47364 WP_003872213.1.4754 WP_003872213.1.50439 WP_003872213.1.50890 WP_003872213.1.52934 WP_003872213.1.53280 WP_003872213.1.53771 WP_003872213.1.55522 WP_003872213.1.55945 WP_003872213.1.56146 WP_003872213.1.56366 WP_003872213.1.56924 WP_003872213.1.58557 WP_003872213.1.59206 WP_003872213.1.59922 WP_003872213.1.60164 WP_003872213.1.62113 WP_003872213.1.62963 WP_003872213.1.63545 WP_003872213.1.64277 WP_003872213.1.646 WP_003872213.1.64827 WP_003872213.1.64833 WP_003872213.1.65674 WP_003872213.1.66027 WP_003872213.1.66499 WP_003872213.1.66905 WP_003872213.1.67083 WP_003872213.1.67285 WP_003872213.1.6888 WP_003872213.1.70933 WP_003872213.1.71252 WP_003872213.1.72172 WP_003872213.1.74562 WP_003872213.1.74957 WP_003872213.1.75798 WP_003872213.1.76287 WP_003872213.1.78145 WP_003872213.1.78536 WP_003872213.1.7926 WP_003872213.1.81101 WP_003872213.1.81559 WP_003872213.1.8174 WP_003872213.1.82097 WP_003872213.1.82175 WP_003872213.1.82859 WP_003872213.1.83216 WP_003872213.1.83808 WP_003872213.1.84212 WP_003872213.1.86358 WP_003872213.1.87305 WP_003872213.1.8774 WP_003872213.1.88396 WP_003872213.1.88567 WP_003872213.1.89157 WP_003872213.1.9350 WP_003872213.1.93735 WP_003872213.1.93753 WP_003872213.1.94747 WP_003872213.1.95123 WP_003872213.1.96060 WP_003872213.1.9734 WP_003872213.1.98356 WP_003872213.1.98724 WP_003872213.1.98852 WP_003872213.1.99050 WP_003872213.1.9971 gi|118464352|ref|YP_881554.1| gi|41407983|ref|NP_960819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]