SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118464553|ref|YP_881974.1| from Mycobacterium avium 104

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118464553|ref|YP_881974.1|
Domain Number 1 Region: 60-200
Classification Level Classification E-value
Superfamily PEBP-like 7.98e-35
Family Prokaryotic PEBP-like proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118464553|ref|YP_881974.1|
Sequence length 202
Comment phosphatidylethanolamine-binding protein [Mycobacterium avium 104]
Sequence
MEATLVDTSRRIGTIICALALPAGAVGCGGHGHGPTTTPSTPKVTTLGRTAPNAPAGGPL
TITSPAFTDGAPIPPRYTCKGEGIAPPLAWSAPTGAALVVDDPDAPAGPYVHWVVTGIAP
GSGSTSAGQTPPGTTTLPNTAGQAGYQGPCPPAGTGTHHYRFTLYQLPNDYQLPAGLAGV
QAAQTIGAAATAQAQLTGVFGG
Download sequence
Identical sequences A0A049D2J6 A0A0H2ZW12 A0A2A3L4I5 V7N4W9 X8B7T3
243243.MAV_2786 gi|118464553|ref|YP_881974.1| WP_011725043.1.12505 WP_011725043.1.14691 WP_011725043.1.16293 WP_011725043.1.17321 WP_011725043.1.20882 WP_011725043.1.21325 WP_011725043.1.22600 WP_011725043.1.2690 WP_011725043.1.31474 WP_011725043.1.32247 WP_011725043.1.35384 WP_011725043.1.40244 WP_011725043.1.42004 WP_011725043.1.42052 WP_011725043.1.42684 WP_011725043.1.44666 WP_011725043.1.48008 WP_011725043.1.49379 WP_011725043.1.51803 WP_011725043.1.57680 WP_011725043.1.6247 WP_011725043.1.62782 WP_011725043.1.6371 WP_011725043.1.65121 WP_011725043.1.65674 WP_011725043.1.65884 WP_011725043.1.66097 WP_011725043.1.66967 WP_011725043.1.68982 WP_011725043.1.70933 WP_011725043.1.74476 WP_011725043.1.7463 WP_011725043.1.75695 WP_011725043.1.7926 WP_011725043.1.80001 WP_011725043.1.80920 WP_011725043.1.85628 WP_011725043.1.87519 WP_011725043.1.94747 WP_011725043.1.95627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]