SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118464791|ref|YP_884048.1| from Mycobacterium avium 104

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118464791|ref|YP_884048.1|
Domain Number 1 Region: 4-479
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.62e-191
Family Heme-dependent catalases 0.00000000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118464791|ref|YP_884048.1|
Sequence length 485
Comment catalase KatA [Mycobacterium avium 104]
Sequence
MTENFTTTNAGAPAPSDELSLTLGPDGPVLLQDFYLIEQLAAFNRERVPERQPHAKGTGA
FGRFEVTNDLSAYTKAAVFQPGTKTDVFVRLSGNAGERGSADTVRDTRGFSVKFYTTEGN
FDLVGLDFPVFVIRDPIKFPQMVRSAKRRANNDCRDHNMQWDFWTLSPESAHQVTMIMSD
RGIPKTFRHMHGFGLHTFSFLNAAGEISWVKFHFKSNQGIEWLTQEEGDRLAGTDPDYCI
RDLYEAIEHGDHPRWSVKVQIMPFEDAKTYRFNPFDVTKVWPHADYPLIDLGTMTLDRNV
TDHHTEVEQVTFAPHALVPGIGLSPDKLLLGRSFAYADAHRYRVGANHNQIPVNAPRCPV
RSYSKDGQMRFVNSTDPVYAPNSYGGPKADPDRASVVKWAVDGGMMVRAPYTLRPDDDDW
GQAGALVRDVMDDAERERLVHNIVHHVTDGVKEPVLSRVVEYWYNIDADIGKRVEDGIRA
ANLGR
Download sequence
Identical sequences A0A0H2ZZ10 V7JF25
WP_011726338.1.12954 WP_011726338.1.14691 WP_011726338.1.17266 WP_011726338.1.17321 WP_011726338.1.32203 WP_011726338.1.35384 WP_011726338.1.62105 WP_011726338.1.65674 WP_011726338.1.69393 WP_011726338.1.70933 WP_011726338.1.72172 WP_011726338.1.74957 WP_011726338.1.93735 WP_011726338.1.94747 gi|118464791|ref|YP_884048.1| 243243.MAV_4927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]