SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118464864|ref|YP_883220.1| from Mycobacterium avium 104

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118464864|ref|YP_883220.1|
Domain Number 1 Region: 21-529
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.96e-215
Family Heme-dependent catalases 0.0000000000224
Further Details:      
 
Domain Number 2 Region: 554-714
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.42e-19
Family Catalase, C-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118464864|ref|YP_883220.1|
Sequence length 721
Comment catalase HPII [Mycobacterium avium 104]
Sequence
MVLPHGRKGRKERQHMATDHTSDAPDPKQRDLESARFRRDTGYLTTQQGVRVDHTDDALT
VGERGPTLLEDFHAREKITHFDHERIPERVVHARGAGAYGYFEPYDDRLAQYTAAKFLTS
PGTRTPVFVRFSTVAGSRGSADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFP
DFVHAVKPEPHNEIPQAQSAHDTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVH
TFRLVNARGEGTFVKFHWKPRLGVHSLIWDECQKIAGKDPDYNRRDLWEAIESGQYPEWE
LGVQLVAEDDEFSFDFDLLDATKIIPEEQVPVLPVGKMVLNRNPDNFFAETEQVAFHTAN
VVPGIDFTNDPLLQFRNFSYLDTQLIRLGGPNFAQLPVNRPVAQVRTNQHDGYGQHAIPQ
GRSSYFKNSIGGGCPALADEDVFRHYTQRVDGQTMRKRAEAFQNHYGQARMFFKSMSPVE
AEHIVAAFAFELGKVEMPEIRSAVVAQLARVDDQLAAQVAAKLGLPEPPEEQVDESAPVS
PALSQVTDGGDTIASRRIAVLAADGVDVVGTQRFTELMEQRGAVVEVLAPVAGGTLAGGS
GGELRVDRSFTTMASVLYDAVVVACGPRSVSTLSDDGYAVHFVTEAYKHLKPIGAYGAGV
DLLRKAGIGNRLAEDTDVLNDQAVVTTKAAADELPERFAEEFAAALAQHRCWQRRTDAVP
A
Download sequence
Identical sequences A0A0H2ZZB0 V7J9T6 V7NBH0 V7P993
gi|118464864|ref|YP_883220.1| 243243.MAV_4069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]