SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|118466934|ref|YP_883043.1| from Mycobacterium avium 104

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|118466934|ref|YP_883043.1|
Domain Number - Region: 14-219
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.017
Family Heme-dependent catalases 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118466934|ref|YP_883043.1|
Sequence length 223
Comment hypothetical protein MAV_3881 [Mycobacterium avium 104]
Sequence
MNVFELATAPFGWGSAIRGKRFFHPDGVLAGGVAERVAPAGRGLPIPPSRIVARLSKATG
TPGALPDFIGLALRVSAPQPAGTPWDILLVSAGSGVLSRAVALRPATSWNAQTLTTLMPL
RYQDANWWLRARTASDIGGAGLALDDVRRRLERGGIEVSLDQACGRGDFTPLARVSLTAV
IDDDVSFDPVVNTAPGVSLHPRWLADLRARAYRHSRDGRDADQ
Download sequence
Identical sequences A0A0H3A391 A0A1X0CBD3 A0A2D1MDP8 X8AZ11
WP_011725726.1.100504 WP_011725726.1.14691 WP_011725726.1.15384 WP_011725726.1.16293 WP_011725726.1.17321 WP_011725726.1.17884 WP_011725726.1.21325 WP_011725726.1.22278 WP_011725726.1.22600 WP_011725726.1.23768 WP_011725726.1.2690 WP_011725726.1.31474 WP_011725726.1.32247 WP_011725726.1.34688 WP_011725726.1.35384 WP_011725726.1.36073 WP_011725726.1.38978 WP_011725726.1.40244 WP_011725726.1.42004 WP_011725726.1.42052 WP_011725726.1.42684 WP_011725726.1.44666 WP_011725726.1.48008 WP_011725726.1.49379 WP_011725726.1.50439 WP_011725726.1.51803 WP_011725726.1.53771 WP_011725726.1.55781 WP_011725726.1.57680 WP_011725726.1.60164 WP_011725726.1.6247 WP_011725726.1.62782 WP_011725726.1.6371 WP_011725726.1.65121 WP_011725726.1.65674 WP_011725726.1.65884 WP_011725726.1.66097 WP_011725726.1.66499 WP_011725726.1.66967 WP_011725726.1.68982 WP_011725726.1.70933 WP_011725726.1.74476 WP_011725726.1.75695 WP_011725726.1.78536 WP_011725726.1.80001 WP_011725726.1.83808 WP_011725726.1.84212 WP_011725726.1.85628 WP_011725726.1.86358 WP_011725726.1.87519 WP_011725726.1.87736 WP_011725726.1.8774 WP_011725726.1.94747 WP_011725726.1.95123 WP_011725726.1.95627 WP_011725726.1.9734 WP_011725726.1.98356 WP_011725726.1.98724 243243.MAV_3881 gi|118466934|ref|YP_883043.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]