SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478486555|ref|YP_007754136.1| from Enterococcus casseliflavus EC20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478486555|ref|YP_007754136.1|
Domain Number 1 Region: 16-231
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.23e-52
Family PP-loop ATPase 0.00015
Further Details:      
 
Domain Number 2 Region: 378-456
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000011
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|478486555|ref|YP_007754136.1|
Sequence length 466
Comment tRNA(Ile)-lysidine synthetase [Enterococcus casseliflavus EC20]
Sequence
MVIQTVRGQLTAIDPEKKRRFLLAVSTGVDSMVLLQIFCQLFPEMQKEPCFGVAHVNHQL
RPASAKEAAFLRQYCQERGIPFYERCWENPPETGVEASARNFRYTFFADVMSQEGYDVLL
TAHHSDDQVETMLMKMMREGRLRSAGGMKQQQPFHTGILLRPLLTVSKAAIYDYAQAQQI
PYFEDESNHEPLYLRNRLRQQVVPALKAENPQLLPHFQQLSEEVQFANQLIQQEQQQWLS
AFVQQQAACLVIDLQQLPTFSSAQRYFFYAGFLQQAEAFTKQPLNQKQLPQLLRLLDEKK
GQWQLALHKQWQLRRSYDQLLLEPVTVPQKPAAPLTEVSQRLVLGEGIYLSEKEWIGYFP
INEQHIPKKITNWSEFSQDLPLNYSSELVVRKRQPGDRIRLARGLTKKISRFFIDSKIPN
EVREKSWVVTNLEKEVIALLPHTFSYLSIAPETDKIHYILLYKYQE
Download sequence
Identical sequences C9ADD5
WP_015510499.1.8541 WP_015510499.1.99503 gi|478486555|ref|YP_007754136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]