SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217969218|ref|YP_002354452.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217969218|ref|YP_002354452.1|
Domain Number 1 Region: 316-398
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000145
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 
Weak hits

Sequence:  gi|217969218|ref|YP_002354452.1|
Domain Number - Region: 170-236
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0863
Family Anti-sigma factor antagonist SpoIIaa 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217969218|ref|YP_002354452.1|
Sequence length 403
Comment sulfate transporter/antisigma-factor antagonist STAS [Thauera sp. MZ1T]
Sequence
MGRPRHRNTDVALPFFGKKPVSPAPGAPRDARAGPGADALRDERPPPTELSALDFTGTDH
GRALARVAGQVEVRECGSGIGAAFEEAAVLYANGSDDDALAVLEAAVGAEGGEGGEGAWL
MLLDLYRLRGERQRFESRVLDYATRFERSPPPWEDLSRVAGKAAGTELPLVNLSGQLSAA
AERQFAQLAKIARRSGGVRIDVAKVRGVDDAGCAVWRGLLAGLAAERLQVRLVNVRALAD
ILSQAVSPGRAQARDTWLMLLELLQYAGDQARFEDVAVDYAVTFEESPPSWEGRGDAPTA
RAAQADEAQSTDPEAFAFEGELCGAANDTLRRLAAFAVERREVRIDCRRLRRLDFVCAGT
LFNILATLQAQGKLVCLRDVNAMVAGLLRVMSVDKVAHVTLRH
Download sequence
Identical sequences C4ZJ43
WP_012584639.1.58410 gi|217969218|ref|YP_002354452.1| 85643.Tmz1t_0787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]