SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217969575|ref|YP_002354809.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|217969575|ref|YP_002354809.1|
Domain Number - Region: 23-76
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0167
Family Anti-sigma factor antagonist SpoIIaa 0.028
Further Details:      
 
Domain Number - Region: 192-261
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 0.0392
Family DmpA-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217969575|ref|YP_002354809.1|
Sequence length 385
Comment hypothetical protein Tmz1t_1154 [Thauera sp. MZ1T]
Sequence
MSAAPRHEARAGEALLAGDGVAAVLRLRGDWTLAHHAALRRQADALRGRIDAATRVELAE
LGTLDTAGARLLHGLLGGERVAALLADEGALSRERRALLKAVADAIEGREERPAADEGYA
LGDVLAHIGHTMLVFWRHVSALTGFIGLILETALRVSVQPRRWRVTALVANLERTGLDAV
PIIALLTFLVGAVVAFLGATVLQNFGASIFTVDLVAYSFLREFGVLLTAIIVAGRTASSF
TAQIGSMRANEEIDAIRVLGLDPVELLVLPRVYALLVALPILTFVAMIAGIVGGMLVSAM
TLDISPVLFLSRIEDNVGLIHFWVGMAKAPIFAFLIAVIGCLEGFRVQGSAQSVGEHTTS
AVVQSIFVVIVVDAIAALFCMEMGW
Download sequence
Identical sequences A0A1V5FC78 C4ZK65
gi|217969575|ref|YP_002354809.1| 85643.Tmz1t_1154 WP_012584895.1.58410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]