SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217970593|ref|YP_002355827.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217970593|ref|YP_002355827.1|
Domain Number 1 Region: 210-342
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 4.05e-33
Family Cell-division protein ZipA, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217970593|ref|YP_002355827.1|
Sequence length 360
Comment ZipA FtsZ-binding protein [Thauera sp. MZ1T]
Sequence
MDSELQIALIGAGIAAVVLVVGYNKWQERRHRREAERAFKSEHRDVLLEPREEPAEGERR
EPGIGAAEDEPRRFSEAPMKRSTPELPRLLDARADCVIRLETIEALEVGRVWAIQAEQLA
GLGKPVYWFGFNDAENVWQPLGPDSSGACHWFCAALQLVNRQGSIGETDFMRFSGGVQRV
ADALMSLPPALPPRGETLRNATELDRFCADVDVQIGINVVSREGQFEGRAIHAVAEKHGL
RLGADGAYHMVDGEHSVFTVANLESGRFSPESLKGLVTRGLTLVIDVPRVSNGGAAFDRM
MKMATTLAGELGGDVVDDNRAPFGAEAATIIRNQIGQFQSRMADHDIPAGSPLALRLFSL
Download sequence
Identical sequences A0A0C3MNT1 A0A1V5FHK3 C4ZJU0 N6YZ95
85643.Tmz1t_2191 gi|217970593|ref|YP_002355827.1| WP_004301383.1.50204 WP_004301383.1.58410 WP_004301383.1.88725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]