SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217969322|ref|YP_002354556.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217969322|ref|YP_002354556.1|
Domain Number 1 Region: 5-90
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000139
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217969322|ref|YP_002354556.1|
Sequence length 94
Comment NTP-binding protein [Thauera sp. MZ1T]
Sequence
MSDPALFAPAGALTMQSAPALLAEGQRRARAGDLVVDLAAVSAADSAALALILDWMRCAR
AAGHALMLRNPPAGLTSLAALYDIDGLLPLERAA
Download sequence
Identical sequences A0A0C3IWJ1 A0A1V5FEP2 C4ZLP8 N6YTU0
WP_004307370.1.50204 WP_004307370.1.58410 WP_004307370.1.88725 85643.Tmz1t_0893 gi|217969322|ref|YP_002354556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]