SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217969661|ref|YP_002354895.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217969661|ref|YP_002354895.1|
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.9e-32
Family Sfri0576-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217969661|ref|YP_002354895.1|
Sequence length 125
Comment hypothetical protein Tmz1t_1240 [Thauera sp. MZ1T]
Sequence
MISTESTDKLVSLVVFGEFTLADYKEFEDVVNYRVQFSGPVDLLFDLRQMAGFTLDVAWE
EIKFSRQHAGDFRRIAVLTEDQWLTWSAWVSQLFVTAEVKVFDDEDEARAWLAAETTAET
TGSAQ
Download sequence
Identical sequences A0A0C3I4G8 A0A1V5FFL1 C4ZLU4 N6YVG3
gi|217969661|ref|YP_002354895.1| WP_004317053.1.50204 WP_004317053.1.58410 WP_004317053.1.88725 85643.Tmz1t_1240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]