SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217969737|ref|YP_002354971.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217969737|ref|YP_002354971.1|
Domain Number 1 Region: 12-95
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000471
Family Anti-sigma factor antagonist SpoIIaa 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217969737|ref|YP_002354971.1|
Sequence length 111
Comment anti-sigma-factor antagonist [Thauera sp. MZ1T]
Sequence
MDTPALDTPAAGVARLAPEGELGIYTVAALREAWLQALATHEALEIDLGRIDEIDTAGLQ
LMLMAKRSVGRSVRFVNHSAAVLRLLDLARLGGALGDPLLEDAAPATQEAR
Download sequence
Identical sequences A0A0C3N837 A0A1V5FGH5 C4ZM20 N6YEI9
WP_004325666.1.50204 WP_004325666.1.58410 WP_004325666.1.88725 gi|217969737|ref|YP_002354971.1| 85643.Tmz1t_1316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]