SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224585022|ref|YP_002638821.1| from Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224585022|ref|YP_002638821.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.14e-110
Family FMN-linked oxidoreductases 0.0000000000449
Further Details:      
 
Domain Number 2 Region: 333-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.94e-41
Family N-terminal domain of adrenodoxin reductase-like 0.000000929
Further Details:      
 
Domain Number 3 Region: 461-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.47e-28
Family C-terminal domain of adrenodoxin reductase-like 0.00000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|224585022|ref|YP_002638821.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594]
Sequence
MSYPSLFAPLDLGFTTLRNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGIALIVTGGI
APVPSGVVMTGGAMLNDASQLTPHRVVTDAVHAEGGKIALQILHTGRYSYQPHLVAPSAI
QAPINRFMPHELTHDEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTRRTNHR
DDEWGGDYASRMRFAVEVVRAVRQRVGNDFIIIYRLSMLDLVENGGTFDETVQLAQAIEA
AGASLINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLIATNRINDPQVAETIL
TRGDADMVSMARPFLADAEFLTKAQSGRADEINTCIGCNQACLDRIFIGKVTSCLVNPRA
CHETHMPITPAIRKKNLAVVGAGPAGLAFAINAASRGHHVTLFDAQSEIGGQFTIARQIP
GKEEFYETLRYYRRMIDVTGVTLKLNQRVNAEDLQPFDEAILACGIVPRRPPIDGIDHPK
VLTYLEVLRDKAPVGKRVAIIGCGGIGFDTAMYLSQHGESTSQNIAEFCTEWRIDTSLQQ
AGGLRPEGPRLARSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDDGLHLLIGGEPQLLEVDHVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences C0PYZ2
WP_000121505.1.15637 gi|224585022|ref|YP_002638821.1| 476213.SPC_3295 CP000857|CDS_3326538-3328556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]