SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434390930|ref|YP_007125877.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434390930|ref|YP_007125877.1|
Domain Number 1 Region: 102-293
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.19e-58
Family BC ATP-binding domain-like 0.00032
Further Details:      
 
Domain Number 2 Region: 4-98
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.45e-25
Family BC N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 3 Region: 299-360
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000118
Family BC C-terminal domain-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434390930|ref|YP_007125877.1|
Sequence length 377
Comment 5-(carboxyamino)imidazole ribonucleotide synthase [Gloeocapsa sp. PCC 7428]
Sequence
MQVKRVGVIGGGQLAWMMATPAQALGVELVIQTPSRDDPAVAIAADTIIAPINDADATQE
LAYRCDVITFENEFVDLAALFPLAESGVCFRPRLEALSPLLDKYHQRCHLEKLGIPQPKF
VLPSSHNQLEFPVVLKTRRHGYDGQGTFIIKDAETLQHKLDTSHKPSEVLLEEFIPFERE
LAVIVARAVNGDVVTFPIVETQQENQVCRRVIAPAAISSTVAQEIEAIAQTLMNSLQAVG
VFGIELFLTGEQKVLVNEIAPRTHNSGHFTIDACATSQFEQHLRAVCNLPLGSSALTCSS
AVMINLLGYEYAQDDYLDKRSQISQIPHAHVHWYGKNESRPGRKLGHVTVLLDEVNPEVA
QAIAQKIESLWYPESNR
Download sequence
Identical sequences K9XAQ3
gi|434390930|ref|YP_007125877.1| WP_015186594.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]