SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391029|ref|YP_007125976.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391029|ref|YP_007125976.1|
Domain Number 1 Region: 22-225
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.77e-43
Family Voltage-gated potassium channels 0.00034
Further Details:      
 
Weak hits

Sequence:  gi|434391029|ref|YP_007125976.1|
Domain Number - Region: 226-256
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.00222
Family NOB1 zinc finger-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391029|ref|YP_007125976.1|
Sequence length 262
Comment Ion transport 2 domain protein [Gloeocapsa sp. PCC 7428]
Sequence
MILLAKKVIGFYLEDIETPLGRFLNLAITGLVLLSSAIFVVETYSIPTELRLVLDKLDSV
IIGIFALEYTLRLWCAESKTKYFFSLYSLIDLLTILPFFLGLVDISFIRILRWFRILRLV
RFLQKIVLFERISGEDSIIFARILFTLFAIIFIYSGLIYQVEHPVNSDTFNTFLDAFYFS
VVTMTTVGFGDVTPISQLGRLLTVLMILTGVALIPWQVGDLIRQFIKTSRQVQTVCPTCQ
LSLHDTDAHYCKICGTKLEKNL
Download sequence
Identical sequences K9X9S5
gi|434391029|ref|YP_007125976.1| WP_015186693.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]