SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391137|ref|YP_007126084.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391137|ref|YP_007126084.1|
Domain Number 1 Region: 561-979
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.06e-141
Family DNA polymerase I 0.0000000118
Further Details:      
 
Domain Number 2 Region: 370-554
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.56e-48
Family DnaQ-like 3'-5' exonuclease 0.00016
Further Details:      
 
Domain Number 3 Region: 11-195
Classification Level Classification E-value
Superfamily PIN domain-like 9.81e-44
Family 5' to 3' exonuclease catalytic domain 0.000022
Further Details:      
 
Domain Number 4 Region: 196-310
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 9.27e-33
Family 5' to 3' exonuclease, C-terminal subdomain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391137|ref|YP_007126084.1|
Sequence length 980
Comment DNA polymerase I [Gloeocapsa sp. PCC 7428]
Sequence
MSQAFTSTVASSSTRPTFILVDGHSLAFRSYFAFAKGRDGGLRTTTGIPTSVCFGFLKAL
LEVMAAEKPEAMAIAFDLGLPTFRHEADDTYKADRPGTPEDFVPDLKNLHELLDGLNLPI
ITAPGYEADDVLGTLAQKASTAGYRVKILTGDRDLFQLVDPQKDISVLYLSSEALKRSST
GINEFRTEQVKEKMGVLPSQIVDFKALCGDKSDNIPGVKGIGEKTAIQLLNQYTSLEQIY
ASLGEIKGATQKKLEAGKQDAEKSRYLATIVVDVPLDIDLEAAKLTGFDTTTLKPILEKL
EFKSFLGKVNELQQQFGGTIPEDESEDTPDSNFIAVPTFESDDLWFFSAEDTEASQEQEQ
PLAKIAPQIIDTPAKLTKLVKQLQKHTNTKTPVAWDTETTDLEPRDAQLVGIGCCWGSEL
DAIAYIPLGHTAGDNLDTATVLSALRPILESAEYPKALQNAKFDRLVLRCQGIHLRGVVF
DPMLASYVLDPDTSHNLSDLAQRYLGLTSKSYAELVPKGKNIADLDIPTVADYCGMDVYA
TYGLVTKLRAELDKIPVLHKLLLEVEQPLEPVLAEMEYTGIHINTAYLQDFSKQLEKDLA
AIEEQIYAVAEEKFNLGSPKKLGELLFDKLNLDRRKSRKIQTGYSTDAATLEKLRDDHPI
VEAILEYRTLSKLKSTYVDALPALVRPDTQRVHTSFNQTATSTGRLSSSNPNLQNIPIRT
AFSRQIRKAFIPESGWILVAADYSQIELRILAHLSQEPILVKAYQNNEDIHTVTARLLFE
KDAVTSEERRLAKTINFGVIYGMGAQRFARETKMKAADGKVFIERFNQQYPLVFEYLRRM
EQEAIAYGYVQTILGRRRYFNFTSDRLRKLRNLKPEDINLDEIRGLTANDAGLLRAAANA
PIQGSSADIIKIAMAQLHELLQNYQARLLLQVHDELVFEVPQDEWEELQPKIRSTMESAV
SLSVPLLVEVRAGENWMEVK
Download sequence
Identical sequences K9XA05
WP_015186801.1.9315 gi|434391137|ref|YP_007126084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]