SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391179|ref|YP_007126126.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391179|ref|YP_007126126.1|
Domain Number 1 Region: 298-526
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-41
Family ABC transporter ATPase domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 66-283
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.75e-22
Family DNA repair protein MutS, domain III 0.013
Further Details:      
 
Domain Number 3 Region: 730-803
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000471
Family Smr domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434391179|ref|YP_007126126.1|
Sequence length 804
Comment MutS2 protein [Gloeocapsa sp. PCC 7428]
Sequence
MIQSETLELLEWSRLCQHLSTFAATKLGATAARNLQIPQSQKQSEALLAQTQEAYQLENS
LTGGLSFDGIQDIGDALTRVQRQGILTGEELLAIATTLAGTRQLRRAIDNQPDVPVLSAL
VEDIRTYPEIEQEIHRCIDERGQVSDRASTTLSNIRSSLRQIRSQITQKLQNILQRQANA
VQEQLITKRGDRFVIPVKAPQKDAIPGIVHDTSTSGATLYVEPNSVVPLGNQLRQLTVKE
QAEETAIRRQLSEQIAAVTPDLEHLLSVATILDLACARARYSYWLKANPPRFIQRGEGET
ITLRQLHHPLLVWQFAHEQGTAVVPVDLVIKPQIRVVTITGPNTGGKTVTLKTLGLAALM
AKVGLFVPAREPVEIPWFDQVLADIGDEQSLQQSLSTFSGHIRRISRIIDALSNTQALTP
HSSLVLLDEVGAGTDPAEGSALAIALLQYLADHTQLSIATTHFGELKALKYQDERFENAS
VEFDEESLSPTYRLLWGIPGRSNALTIARRLGLNAEVVEQAKTKIGGATEDVNQVIAGLE
AQRRLQETKAAEAEQLLQQVQRLYTEVSQKAAQLQEREAHLRQQQEQSIQQALVQAKSEI
AQVIRRLQQGSTTAQDAQQATNALTQIAKNHLPPPPKPKPGFKPQVGDRIRIPRLEQTAE
VISAPDEDGELSVRFGIMKMNVKLEDIESLDGQKAEPVTTKKQVKETPRNSPKQDAPTTP
QSALAIRTSQNTIDLRGSRVADAEIVLERAIAQAQGRLWIIHGHGTGKLRQGVHTFLQQN
PRVNRFEPAAPEDGGTGVTVAYIE
Download sequence
Identical sequences K9XA69
WP_015186843.1.9315 gi|434391179|ref|YP_007126126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]