SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391192|ref|YP_007126139.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391192|ref|YP_007126139.1|
Domain Number 1 Region: 123-401
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.35e-67
Family Alanine racemase-like, N-terminal domain 0.003
Further Details:      
 
Domain Number 2 Region: 510-614
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00000129
Family Eukaryotic ODC-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391192|ref|YP_007126139.1|
Sequence length 687
Comment arginine decarboxylase [Gloeocapsa sp. PCC 7428]
Sequence
MGVELSTNSALESQPPLELQPQKQEQASEAKKAADNGYKAEQNNKKSLSNPKTETLPQRK
WKIEDSEALYRIDGWGEPYFSINAAGHVTVSPKGDRGGSLDLYELVNALKQRNLSLPLLI
RFSDILEDRIQRLNACFAKAIARYNYPGVYRGVYPVKCNQQKHLIEDLVRFGQPHQFGLE
AGSKPELMIALAMLDTPGALLVCNGYKDREYIEIAMLATRLGQTPIIVLEQIEEVDLVIN
ASRQLGIRPILGVRAKLSTQGMGRWGTSSGDRAKFGLTIPEIIQAVDKLRDANLLDSLQL
LHFHIGSQISAINVIKDAIQEASRIYVELAQLGADMKYLDVGGGLGVDYDGSQTNFYASK
NYNMQNYANDIVAELKDACAERKMPVPTLISESGRAIASHQSILIFDVLSTCDVPSGSPE
PPRPEEPPLIHNLWETFQSINVENYQEAYHDITQFKEESISRFNLGILSLTERARVERIY
WACCEKIMGITRQQEYVPDDLEELEKIMASIYYVNLSVFQSAPDCWAIDQLFPIMPIHRL
DEEPTRRGILADLTCDSDGKIDKFIDLRDVKSVLELHTFKPDEPYYLGMFLSGAYQEIMG
NLHNLFGDTNAVHIQLTPKGYQIEHVVKGDTMTEVVGYVQYDSEDLVESIRQRTEQALEE
KRITLAESQRLLQTYEQSLSRYTYLSP
Download sequence
Identical sequences K9XA65
WP_015186856.1.9315 gi|434391192|ref|YP_007126139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]