SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391327|ref|YP_007126274.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391327|ref|YP_007126274.1|
Domain Number 1 Region: 564-892
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.96e-102
Family Quinoprotein alcohol dehydrogenase-like 0.039
Further Details:      
 
Domain Number 2 Region: 809-1096
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-98
Family WD40-repeat 0.00000613
Further Details:      
 
Domain Number 3 Region: 91-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.57e-38
Family Extended AAA-ATPase domain 0.042
Further Details:      
 
Domain Number 4 Region: 1072-1155
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000255
Family All0351-like 0.084
Further Details:      
 
Weak hits

Sequence:  gi|434391327|ref|YP_007126274.1|
Domain Number - Region: 518-559
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000419
Family Pentapeptide repeats 0.029
Further Details:      
 
Domain Number - Region: 7-64
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0114
Family Sigma3 domain 0.085
Further Details:      
 
Domain Number - Region: 372-479
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.0353
Family TF C-terminus 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391327|ref|YP_007126274.1|
Sequence length 1207
Comment (Myosin heavy-chain) kinase [Gloeocapsa sp. PCC 7428]
Sequence
MNSEEALAIVQTLAEEPLSKLQASVFRYAWEEQPYQEIAKQLGYEVGYLKQTGSQLWQVL
SRAFGEKVSKSNVQLVLKRKARELTAECVGDSISNLKCDWGNAPDVSVFYGRNAELATLE
QWIMRDRCRWVGLYGMGGIGKTCLAVKLAREIQSDFEYIIWRSLRNAPPILDLLADLIQF
LSQQRETDLPNTLDSCILQLLQYLRAHRCLLILDNGETILRSPSTDEAYTQLFKSIAQTH
HQSTLVLTSREKPNSIAVEEGENLPVRSLRLSGLNESAIKKIFDTKGFFTASHPEWKLLI
EHYAGNPLALKIVAAGIQNFFDSSISNFLEVLPQGAIVFGDIRDLLASQINHLPELELHI
LYWLAINREPVTLSELKTDISSQIALGELLDAIAGLERKCLVDKVAPTLSENGKFTLQPV
VMEYVTDRLIHQIYEEINHKTIHLFNSHALIKATTKDYIRETQKRLILQPITDKLINNNS
KANLETKFQQILCNLRNKPQRVAGYAGGNILNILCYLQTDLSSWDFSQISIWQAYLCCSN
LQQVNFTSAHFAKSVFTDTFSQVLSVAFSPDGKLLATGDVNHEIHVWQVTDGKQVLTCKV
DAGWLWCVAFSPNGRHLASSANCTVNLWDVQTGECIKSFPGYTDRVFSVAFSPDGRMLAS
GSEDRLVRVWDIKTGELLHTFAGHTDEVRSVAFAPQHYAHSHHGGLLASGSFDGTVRVWN
IDTGECLKLAEHQQKVWSVAFSPDGSIIASGSSDRTIKLWDVRTGTSIKTITAHSQQIRT
VAFSGDGQTLASGSDDQSVRIWNYHTGEVLRVLKGHTSWISTVAFSPNHYLLASSSEDRS
VRLWDSRNNFCLKTLQGHSNGVWCVAFSPDGTQLASGSQDRLIRLWDTTTGKHLGSLQGH
TSWIWSVAFHPEGNVLASGSEDRTIRLWDTQTRQHLTTLKGHADAVFAVIFSPDGKTLFS
GSLDGTIRLWNIQQQTCHPWQGHRGGVWSIALSLDGTLLASGSQDQTIKLWDVQTGCCIK
TLSGHTSWIRACAISCDRQYLVSGSADGVIKVWQIETGQCIQTLQAHQGPVLSIVFDPSG
ENFATCGTDAVIKLWQWHPTCTISKTLHGHSKWVRFLAYNSDGLLASCSQDETIKLWNFN
GDRNLTHKTLQVPRPYEGMNITDAQGLTEATMTTLKTLGAIDSNTLAGVREQGQQLVGVM
LLSSTVS
Download sequence
Identical sequences K9XAJ7
gi|434391327|ref|YP_007126274.1| WP_015186991.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]