SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391493|ref|YP_007126440.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391493|ref|YP_007126440.1|
Domain Number 1 Region: 154-295
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.45e-37
Family Potassium channel NAD-binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 44-171
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.96e-25
Family Voltage-gated potassium channels 0.00085
Further Details:      
 
Domain Number 3 Region: 302-380
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 2.09e-16
Family TrkA C-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391493|ref|YP_007126440.1|
Sequence length 393
Comment TrkA-N domain protein [Gloeocapsa sp. PCC 7428]
Sequence
MRVRRYSPLDKQSPQEVDFGFSVQNGIRLNVVSAGNVFSSQAEFEQKYRRIRRELTLSVI
GLGVVLLVGTLWYWLVEGWSWIDAAYMTVITLATVGYSETRPLGDRGRLFTVTLIIMGVI
SIGYIVNRFTDALVQGYFQIGFQLRQQRLLIDSLSDHYIICGFGRTGRQIALEFATEAIP
FVTVDSDPESVQAAQQLGYTVVEGDATLDEVLLKVGVDRATCLVAALPSDAENLYTVLSA
KALNPQIRAIARASTQEALQKLQRAGADAVVSPYITGGRRMAAAALRPQVMDFVDGILTG
AGRELYMEEVRLDADTCPCIGQNLGAARLRSQTGALVLAIRRRDGTLIGGPTADTQLMAG
DLLICMGTAEQLRRLNQILGPINSKLPRPPKHN
Download sequence
Identical sequences K9X9F5
WP_015187157.1.9315 gi|434391493|ref|YP_007126440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]