SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391543|ref|YP_007126490.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391543|ref|YP_007126490.1|
Domain Number 1 Region: 19-240
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.3e-57
Family Class I glutamine amidotransferases (GAT) 0.00000799
Further Details:      
 
Domain Number 2 Region: 197-455
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.97e-55
Family N-type ATP pyrophosphatases 0.00000278
Further Details:      
 
Domain Number 3 Region: 414-534
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 5.1e-54
Family GMP synthetase C-terminal dimerisation domain 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391543|ref|YP_007126490.1|
Sequence length 534
Comment GMP synthase (glutamine-hydrolyzing) [Gloeocapsa sp. PCC 7428]
Sequence
MTIQTQTPPQTTSKQLDRQMIVILDFGSQYSELIARRIRETQVYSEVVSYRTTVEQLQQL
NPKGIILSGGPNSVYDVGAPQCDPQIWELGIPILGVCYGMQLMVNQLGGNVVRAERGEYG
KASLLIDDPTDLLTNVEDGTIMWMSHGDSCTALPEGFEVLAHTENTSCAAIAHHEKKLYG
VQFHPEVVHSLGGMALIRNFVYHICDCEPTWTTEAFVDEAIREIRAKVGDKRVLLALSGG
VDSSTLAFLLHKAIGDQLTCVFIDQGFMRKLEPERLVKLFQEQFHIPVEYVKARDRFLAA
IAGVTDPEEKRRRIGHEFIKAFEDASKRLGPFDYLAQGTLYPDVIESADTNVDPKTGERV
AVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSIGLPDEIVQRQPFPGPGLAIR
ILGEVTEERLEILRDADLIVRQEINRNGIYNQLWQAFAVLLPIRSVGVMGDQRTYAYPIV
LRLVSSEDGMTADWARVPYDLLETISNRIVNEVRGVNRVVYDITSKPPGTIEWE
Download sequence
Identical sequences K9X9K3
gi|434391543|ref|YP_007126490.1| WP_015187207.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]