SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391611|ref|YP_007126558.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391611|ref|YP_007126558.1|
Domain Number 1 Region: 298-499
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 7.72e-50
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000311
Further Details:      
 
Domain Number 2 Region: 832-1026
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.7e-48
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000033
Further Details:      
 
Domain Number 3 Region: 567-671
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.92e-31
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00043
Further Details:      
 
Domain Number 4 Region: 672-722,809-858
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.59e-28
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0022
Further Details:      
 
Domain Number 5 Region: 136-183,276-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.76e-28
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00069
Further Details:      
 
Domain Number 6 Region: 39-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.15e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0001
Further Details:      
 
Domain Number 7 Region: 184-274
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 7.59e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00028
Further Details:      
 
Domain Number 8 Region: 723-807
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 9.42e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391611|ref|YP_007126558.1|
Sequence length 1048
Comment transporter, hydrophobe/amphiphile efflux-1 (HAE1) family [Gloeocapsa sp. PCC 7428]
Sequence
MFVELFIKRPVVSIVCAIIVVLLGAASIPNLPIAQYPEIAPPQVTVTANYIGASAEVVEN
TVTNILEQAVNGAEGVRYISSSSSNNGNSSINLTFETGRNIDLAAVDVQNRVATVQPQLP
ESVQRTGVRVLKQSTGFLMAIGLFSDNGQYTNTFLSNYADLYIVDALRRIQGVSDVQVFG
ERRYAMRLWVDPERLASRALTMQDVVNALNEQNIQVGAGQLGQPPIPNEQQYQLDLEART
QFNDVSQFEDLILRTEENGSLVRFRDVGRVELGAQDYSTILRFQGIEATGLGISQLPGSN
ALEVAAAVKAELAQLAQRFPPGMEYQIAFDTTAFVQQSLTEVATTLIQAIALVVLIIFIF
LQDWRTTLIPAITIPASLLGTFIFVQVFGFSINTLTLFGLTLATGMVVDDAIIVVENISR
LIQDKGMNPRAAAIESMRELTSAVIATSLVLMAVFVPVAFFPGSTGALYRQFALTIAFSI
TVSTFLALTFTPSMSAKLLRQGQHPPRWLAWFFDRFNRFLDSSQRSYARSLRTLMRFKMI
VLGIFILSLGLTAWMFARVPSGFLPEEDQGYFITLVQAPEGVSLNYTSDVIARVEKELQQ
IPEITSSFAVAGFSFTGSSANNGIVFSSLRPWEERREPGQSVDAIIGQLFGRFATITEAR
ILPLNPPAIQGLGTFGGFSFQLQDRRGVNDLNALVQAAGQIMAQANQTPGLQQVFTTFAA
STPKLSIDIDRNTAKALQVSVDDILNTLQTAIASQYVNDFTLGQRNYRVYVQADQQFRSS
PGDISRLYVRSALGEMIPLSNLVSLTPETGAQTINHFNLFRSIEITGSPAQGYSSGDAIQ
AMEDVAANVLPPGLDYQWSGTSLEEIESGGQAPIIFGLGLVFVFLVLAAQYENFIDPFII
MLAVPLAILGALIAQSLRGLINDVYCQVGLVMLIGLASKNSILIVEFANQLRAEGLPLVK
AAIEAARERLRPILMTAISTLVGIFPLVVATGAGAGSRQSLGTAVFGGMLVATFLSLFII
PVLYVVVVSLEESVRDRFGWSKSDATDG
Download sequence
Identical sequences K9XA71
gi|434391611|ref|YP_007126558.1| WP_015187275.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]