SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391631|ref|YP_007126578.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391631|ref|YP_007126578.1|
Domain Number 1 Region: 41-225
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000218
Family GAF domain 0.0093
Further Details:      
 
Domain Number 2 Region: 243-464
Classification Level Classification E-value
Superfamily PP2C-like 0.00000000419
Family PP2C-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434391631|ref|YP_007126578.1|
Sequence length 466
Comment serine phosphatase [Gloeocapsa sp. PCC 7428]
Sequence
MPVSQSSSQPTADRNSNANTDSTPILALKQLVARLHKEQHKIHDLLSSLGFALRSFNNLN
QFLELIPLMATRVTDADGGALVLFKPNGQVRLERLHCQDSRQSQNIRKALETAIGAVTAS
LTTAPKIVPAAATAALDDQVSRYLGSDIQLFGTTIFVKQSERGRLYVFSSKPEYTWTENR
QKLVRLVADQTAVAIENDELTAELRKKERMNRELEIGAEIQLRLLPRQCPKIAGIALAAR
CQPASHIGGDYYDFIPTNCHPSEAKQSGDTPCRWGIVIGDVMGKGVPAGLLMTMTQGILR
AEVPNGNSPAQILQKLNQVIYAHLENSHRFITLFCSAYDPQTQTLYYSNAAHNPPLLWQA
ATGNVKRLDTWGMLIGLDAQSQYEDAHIQLHPGDTIIYYTDGFTDAANQSGDRFDEENLI
RHFYWACQHCQEPQAILEYLFEQVYRFTGSANQNKDDMTLVVLQAN
Download sequence
Identical sequences K9XA86
WP_015187295.1.9315 gi|434391631|ref|YP_007126578.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]