SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391637|ref|YP_007126584.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391637|ref|YP_007126584.1|
Domain Number 1 Region: 120-269
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 5.49e-40
Family Aspartate/glutamate racemase 0.00029
Further Details:      
 
Domain Number 2 Region: 17-118
Classification Level Classification E-value
Superfamily Aspartate/glutamate racemase 3.24e-36
Family Aspartate/glutamate racemase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434391637|ref|YP_007126584.1|
Sequence length 281
Comment glutamate racemase [Gloeocapsa sp. PCC 7428]
Sequence
MADTSVSSHSHQIQNAPIGIFDSGLGGLTVLHQLYRQLPQESIIYFGDTARVPYGTRSPG
EIVQFMREILTWMLQQQVKMVVTACNTSSALALNIVQKEFPIPIIDLILPGAKAAVQQGK
RIGVIATPATAASNAYKRAILEIDPSVQVWQVGCPEFVPLIEQNRIHDPYTKEVARDYLT
FLLQQRIDTLVYGCTHYPHLAPVLRSLLPQSVKLIDPAEYVVAATAQELELLGLKNTHPP
SPTRFCVTGCPRQFAQSSLPWLGYTPDVEAVCLAPAQSRLV
Download sequence
Identical sequences K9XBG4
WP_015187301.1.9315 gi|434391637|ref|YP_007126584.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]