SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391691|ref|YP_007126638.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391691|ref|YP_007126638.1|
Domain Number 1 Region: 4-345
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.25e-83
Family Deoxyhypusine synthase, DHS 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434391691|ref|YP_007126638.1|
Sequence length 368
Comment homospermidine synthase (spermidine-specific) [Gloeocapsa sp. PCC 7428]
Sequence
MAIPSKKIAPVPIASDIGVVELIDNYFTAYNSARLREICQLLSREVLREGVTVGMSISGA
MTPAGFGVSALAPLIRHGFIDWIISTGANLYHDLHYGLGMKLYSSSPFLDDVKLREQGTI
RIYDIIFDYDVLLETDAFIRKILQAEPFQKRMGTAEFHNLLGKYVREIEKQVGVQHSCLL
ATAYECGVPIYTSSPGDSSIGMNVAALSLSGSKMTIDPSIDVNETAAIAYCARESGISDV
EGKSAAVIIGGGSPKNFLLQTQPQLHEVLGLEERGHDYFIQVTDARPDTGGLSGATPSEA
VSWGKVDPEELPSTLVCYTDSTIALPIITAYVMNQCQPRPLKRLYDRREEMYSKLQHDYQ
QAQLVSAS
Download sequence
Identical sequences K9XAD8
WP_015187355.1.9315 gi|434391691|ref|YP_007126638.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]