SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391716|ref|YP_007126663.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391716|ref|YP_007126663.1|
Domain Number 1 Region: 35-497
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.03e-168
Family Type II DNA topoisomerase 0.000000000702
Further Details:      
 
Domain Number 2 Region: 530-830
Classification Level Classification E-value
Superfamily GyrA/ParC C-terminal domain-like 4.71e-63
Family GyrA/ParC C-terminal domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434391716|ref|YP_007126663.1|
Sequence length 832
Comment DNA topoisomerase IV subunit A [Gloeocapsa sp. PCC 7428]
Sequence
MAKQLNLLSQGQVIPTALHTEMQRSYLEYAMSVIVGRALPDVRDGLKPVHRRILYAMHEL
GLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQDFSSRYPLLAGHGNFGSVDND
PPAAMRYTETRLAPISHEALLAEIGEETIEFISNFDNSQQEPVVLPAQLPVLLLNGCAGI
AVGMATNIPPHNLGELVDGLIALIDQPELSDEKLFELIPGPDFPTGGEIIGTAGIREAYS
TGRGSMTLRGVAKVEEVPGGRGSKRRTAIVITELPFQVNKAGWIEKVAELVNQGRLEGIA
DIRDESDRTGMRVVIELKRDNNPQDVLQHLYHQTALQVNFGAILLALVDGQPRQLSLREL
LREFLKFREETLNRRYTHQLHQAESRIHIVSGLLRALSHLDDVIAILRQASDGSTAKMTL
QSRFDLTETQADAILAMPLRRLTNLEQENLKKEFEALNAQIQDLQKLLNDRRELLKALKK
DLRSLKRKFGDARRTKLAHNVQPFAEEKTGEKQKSQSKPQALPLDVQPVEEVVLEFTQRG
YVKRSPNGQRGSRKSKAENGNSEYDCVIQTQSAKTDQTLLVLTSSGKVFPVQVGEIPASV
RGEKRGSPLIGLLPNSAAAETVAAQFLLPDDPETTQLVLLTKLGKIKRLAMTEFLSITNR
GLTIIKFKDDDELLSALVVQPEQNLVLATIGGRLLRFPVNDEQLPIMGRTAVGLQALRLR
KQEQLVGGVVLDNLGNNVLLVSQSGAAKRVSASTLRQGNRGDIGTQAMQFTSKSDALAGM
VLATDEAALVTNTQRVVRIPINKVTVRGKDGAGDRIAELNPGEKVIEVVAID
Download sequence
Identical sequences K9XAG2
WP_015187380.1.9315 gi|434391716|ref|YP_007126663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]