SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434391776|ref|YP_007126723.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391776|ref|YP_007126723.1|
Domain Number 1 Region: 127-273
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.63e-60
Family C-terminal domain of ribosomal protein L2 0.00000187
Further Details:      
 
Domain Number 2 Region: 4-124
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.77e-50
Family Cold shock DNA-binding domain-like 0.00000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434391776|ref|YP_007126723.1|
Sequence length 287
Comment LSU ribosomal protein L2P [Gloeocapsa sp. PCC 7428]
Sequence
MGTRSYRPYTPSTRQRVVSDFSEITKTEPERSLTVSVHRAKGRNNRGVITSRRRGGGHKR
LYRVIDFKRNKHNIPAKVAAIEYDPNRNARIALLYYQDGEKRYILQPNGLKVGQTVISGP
DAPFEDGNALPLSRIPLGTTVHNVELYPGRGAQIVRAAGASAQVVAKEGNYVTLKLPSGE
VRLIRRECYATIGQVGNIDARNLSSGKAGHNRWKGRRPKVRGSVMNPVDHPHGGGEGRAP
IGRPGPVTPWGKPTLGAKTRKPKKASNALIVRRRRKSSKRGRGGRES
Download sequence
Identical sequences K9XAQ0
WP_015187439.1.9315 gi|434391776|ref|YP_007126723.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]