SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391783|ref|YP_007126730.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391783|ref|YP_007126730.1|
Domain Number 1 Region: 15-259
Classification Level Classification E-value
Superfamily Folate-binding domain 1.4e-59
Family Aminomethyltransferase folate-binding domain 0.0022
Further Details:      
 
Weak hits

Sequence:  gi|434391783|ref|YP_007126730.1|
Domain Number - Region: 265-339
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00719
Family Aminomethyltransferase beta-barrel domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434391783|ref|YP_007126730.1|
Sequence length 341
Comment folate-binding protein YgfZ [Gloeocapsa sp. PCC 7428]
Sequence
MQQLRNMQANTGASFSDDATALQVSQQKAVLYDRSHWGRIEVSDGDRLRFLHNQSTNDFE
QLKPGQGCDTVFVTSTARTIDLATAYVTEDAVLLLVSPNRREFLIEWLDRYIFFADRVQL
KDVTPETAAFSLIGPESDAVVQQLGAGTIINQPYGHHTVVQLGESEVSIAVGSGLALPGY
TLIVPVAAAATVWNKIVQAGVEPISDRVWEQLRILQGRPVPECELTDDYNPLEAGLWNAI
SFNKGCYIGQETIARLNTYQGVKQKLWGIRLESLVEPGSAIAVADEKVGKLTSCIKTAQG
YFGLGYIRTKAGGVGLKVKVGESEGEVIDVPFLTHEYYRGE
Download sequence
Identical sequences K9XAA4
gi|434391783|ref|YP_007126730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]