SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391862|ref|YP_007126809.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391862|ref|YP_007126809.1|
Domain Number 1 Region: 29-79
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00000000165
Family GSPII protein E N-terminal domain-like 0.033
Further Details:      
 
Weak hits

Sequence:  gi|434391862|ref|YP_007126809.1|
Domain Number - Region: 166-268
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit III-like 0.0106
Family Cytochrome c oxidase subunit III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434391862|ref|YP_007126809.1|
Sequence length 366
Comment hypothetical protein Glo7428_1076 [Gloeocapsa sp. PCC 7428]
Sequence
MRCHDDGQRDHQDEELLMVTKVKKDIEQQKPLGRYLIEAGFISSEQLKAALAAQRSEKKR
LGEILVKKGWIRQQTLDYLIEKVVLPERSSQKNLRLVQKDYQRHLESVDAKQLVHIPRQK
LEIPVSPYKTTRLLFYIAVALLGAHLVGQFTEHFLPDYVSRDFIAEQLNLDRELNIPTIY
AMGLLLISSILLAIIAYAKHVRGDRQVRHWVALSIIFLCLAIDEITSLHERMTDPLRSMF
NASGLLHYAWIVPGIVFVLVCLLAFAKFLKNLPSKTRQLILLAGVIFVSGAIGIEAIGGY
YAQVYGEQNMGYALIAGIEEFFEMLGVIIFIYALLSHLVDAMKGLSVRFEIVAHRPSNTQ
FIHPRV
Download sequence
Identical sequences K9XC38
WP_015187525.1.9315 gi|434391862|ref|YP_007126809.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]