SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391871|ref|YP_007126818.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391871|ref|YP_007126818.1|
Domain Number 1 Region: 293-592
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.53e-90
Family DNA repair protein MutS, domain III 0.00000159
Further Details:      
 
Domain Number 2 Region: 594-830
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.25e-59
Family ABC transporter ATPase domain-like 0.000000644
Further Details:      
 
Domain Number 3 Region: 129-193,223-305
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 6.67e-44
Family DNA repair protein MutS, domain II 0.00034
Further Details:      
 
Domain Number 4 Region: 8-127
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.49e-35
Family DNA repair protein MutS, domain I 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|434391871|ref|YP_007126818.1|
Sequence length 852
Comment DNA mismatch repair protein MutS [Gloeocapsa sp. PCC 7428]
Sequence
MLRNADYRKLDITKLSPMYQHFVQVKEQYPNTILLYRCGDFFETFFLDALTVSRELELVL
TSKEGGKEIGRVPMTGVPHHALERYCAMLVEKGYAIAICDQVEDAEIAAAQHRQVRREVT
RVLTPGTLLDDGMLQARRNNFLAAVVIAGNHWGLAYADISTGEFLTTQESNLEQLTQELM
RLQPSEVLVPTNAPDLGSLLRPGETSEHLPACLPPAFCYALRSHTAFTQSEARQRLIQKF
RVRSLEGLGCEHLPLAVRAAGGLLQYLEETQKENPIALQALRTYTISDYLILDHQSRRNL
EITQTVRDGTFHGSLLWALDRTSTAMGGRALRRWFLQPLIDIKGIHARQDTIEELIEDSS
LRQDLRSCLRQIYDLERLTGRAGSGSANARDLVALADSLARLPEIARIVETARSPYLRAL
QKVPAVLEELAAKLRNYLVESPPILLSEGGLIRPGVHSQLDERRTTVEADQQWIANLEVE
ERLKTEIPTLKVGYNKTFGYYISISRSKADQVPQHYIRKQTLTNEERYITPELKERESRI
LNARDDLNRLEYEVFAQLRSEVAEHAELIRNISRAVAAADVLCGLAEVAVYQGYCRPEMV
EGREIHIVDGRHPVVEQSLPAGFFVPNSTFLGSSDDQSPDLIILTGPNASGKSCYLRQVG
LIQLMAQVGSFVPASSARLGICDRIFTRVGAVDDLATGQSTFMVEMNETANILNHATRRS
LVLLDEIGRGTATFDGLSIAWAVAEYLATEIQARTIFATHYHELNELASILTNVANYQVT
VKELPDQIIFLHQVQPGGADKSYGIEAGRLAGLPTVVIQRAKQVMGQIEKHSKIAVGLRE
GIAVERPIIKAN
Download sequence
Identical sequences K9XAZ3
gi|434391871|ref|YP_007126818.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]