SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434391915|ref|YP_007126862.1| from Gloeocapsa sp. PCC 7428

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434391915|ref|YP_007126862.1|
Domain Number 1 Region: 15-237
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.73e-58
Family PP-loop ATPase 0.00021
Further Details:      
 
Domain Number 2 Region: 216-323
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 2.62e-21
Family MesJ substrate recognition domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434391915|ref|YP_007126862.1|
Sequence length 333
Comment tRNA(Ile)-lysidine synthase [Gloeocapsa sp. PCC 7428]
Sequence
MACSDWSLLHAKVHRTLRSRCLLPRDRRILVAVSGGQDSLCLMKLLLDLQSKWRWHLGIA
HCNHQWRSDAAANATYVAQLAQAWNTPFYSETTDRVLRSEAAARQWRYQALSAIAQKHQY
QYIVTGHTASDRAETLLYNLIRGSGADGLQSLTWYRALTPEISLVRPLLEVTREETAQFC
QDMQLEVWEDSTNQDLKYARNRIRQELLPYLHQFNPKVEQTLAQTAEIFHAEVEYLESVA
HQLQQKATITNDDATVKLDCFVLRNAPLALQRRVIRRVLQQTLQTAPSFVQIEKIITLIT
APNGSQTDPLPGGAIAQIKQNCLWIYSSVVEEK
Download sequence
Identical sequences K9XDF9
WP_015187578.1.9315 gi|434391915|ref|YP_007126862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]